PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn051551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 172aa    MW: 18748.4 Da    PI: 8.6031
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn051551genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47.1e-45131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lp ++r da++s+vyeA+ar+rdPvyG+vg i++lq+q++ l+++lal+++
  Achn051551  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPVHQRGDAVKSMVYEANARVRDPVYGCVGAISSLQHQIDILQTQLALAQA 111
                 7**********************************************************************************************9997 PP

      DUF260 100 e 100
                 e
  Achn051551 112 E 112
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.55912113IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKEGGRKQGA ATPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPVHQRGDAV KSMVYEANAR VRDPVYGCVG AISSLQHQID ILQTQLALAQ AEVVHMRMRQ  120
GPSSTFTNPA TGSPENGSYR AIPISQTNKS FFNMDIMVVD QPNTGESLWS C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882228.19e-96PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-76LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA5BKW91e-91A5BKW9_VITVI; Putative uncharacterized protein
STRINGVIT_19s0027g01120.t013e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-78LOB domain-containing protein 4